![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries) |
![]() | Domain d1w60a2: 1w60 A:127-255 [120649] automated match to d1plqa2 |
PDB Entry: 1w60 (more details), 3.15 Å
SCOPe Domain Sequences for d1w60a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w60a2 d.131.1.0 (A:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]} gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh lkyylapki
Timeline for d1w60a2: