SCOPe 2.05: Domain d1w5za3: 1w5z A:97-211

Lineage for d1w5za3 (1w5z A:97-211)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d1w5za3: 1w5z A:97-211 [120647]
   Other proteins in same PDB: d1w5za1
   automatically matched to d1av4_3
   complexed with cu, gol, na, so4

Details for d1w5za3

PDB Entry: 1w5z, 1.86 Å

PDB Description: agao covalent complex with benzylhydrazine

PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d1w5za3:

Sequence; same for both SEQRES and ATOM records:

>d1w5za3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d1w5za3:

• d1w5za3 first appeared in SCOP 1.73
  
• d1w5za3 appears in SCOPe 2.04
  
• d1w5za3 appears in SCOPe 2.06
  
• d1w5za3 appears in the current release, SCOPe 2.08