SCOPe 2.08: Domain d1w5rb_: 1w5r B:

Lineage for d1w5rb_ (1w5r B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein automated matches [190090] (5 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [186812] (1 PDB entry)

8. Domain d1w5rb_: 1w5r B: [120644]
   Other proteins in same PDB: d1w5ra1
   automated match to d1gx3a_

Details for d1w5rb_

PDB Entry: 1w5r, 1.45 Å

PDB Description: x-ray crystallographic structure of a c70q mycobacterium smegmatis n- arylamine acetyltransferase

PDB Compounds: (B:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d1w5rb_:

Sequence; same for both SEQRES and ATOM records:

>d1w5rb_ d.3.1.5 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
mdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklv
drrrggyqyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadg
rylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftte
prpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsa
aqvldaivnrfgidlgdlagrdvqarvaevldt

Timeline for d1w5rb_:

• d1w5rb_ first appeared in SCOP 1.73, called d1w5rb1
  
• d1w5rb_ appears in SCOPe 2.07