Lineage for d1w4ya1 (1w4y A:1-306)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644948Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 644949Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 644950Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 645134Protein Plant peroxidase [48125] (6 species)
  7. 645137Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (30 PDB entries)
  8. 645156Domain d1w4ya1: 1w4y A:1-306 [120641]
    automatically matched to d2atja_
    complexed with ca, cmo, hem

Details for d1w4ya1

PDB Entry: 1w4y (more details), 1.6 Å

PDB Description: ferrous horseradish peroxidase c1a in complex with carbon monoxide
PDB Compounds: (A:) horseradish peroxidase c1a

SCOP Domain Sequences for d1w4ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ya1 a.93.1.1 (A:1-306) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOP Domain Coordinates for d1w4ya1:

Click to download the PDB-style file with coordinates for d1w4ya1.
(The format of our PDB-style files is described here.)

Timeline for d1w4ya1: