SCOPe 2.08: Domain d1w4ta1: 1w4t A:1-277

Lineage for d1w4ta1 (1w4t A:1-277)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein Arylamine N-acetyltransferase [54048] (4 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142855] (1 PDB entry)
   Uniprot Q9HUY3 1-277

8. Domain d1w4ta1: 1w4t A:1-277 [120639]
   Other proteins in same PDB: d1w4ta2
   complexed with so4

Details for d1w4ta1

PDB Entry: 1w4t, 1.95 Å

PDB Description: x-ray crystallographic structure of pseudomonas aeruginosa arylamine n-acetyltransferase

PDB Compounds: (A:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d1w4ta1:

Sequence; same for both SEQRES and ATOM records:

>d1w4ta1 d.3.1.5 (A:1-277) Arylamine N-acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]}
mtpltpeqthaylhhigiddpgppslanldrlidahlrrvafenldvlldrpieidadkv
fakvvegsrggycfelnslfarlllalgyelellvarvrwglpddapltqqshlmlrlyl
aegeflvdvgfgsanppralplpgdeadagqvhcvrlvdphaglyesavrgrsgwlplyr
fdlrpqlwidyiprnwytsthphsvfrqglkaaitegdlrltladglfgqragngetlqr
qlrdveelldilqtrfrlrldpasevpalarrlagli

Timeline for d1w4ta1:

• d1w4ta1 first appeared in SCOP 1.73
  
• d1w4ta1 appears in SCOPe 2.07