SCOPe 2.08: Domain d1w4qa_: 1w4q A:

Lineage for d1w4qa_ (1w4q A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d1w4qa_: 1w4q A: [120637]
   automated match to d1a2wa_
   complexed with umf

Details for d1w4qa_

PDB Entry: 1w4q, 1.68 Å

PDB Description: binding of nonnatural 3'-nucleotides to ribonuclease a

PDB Compounds: (A:) Pancreatic Ribonuclease A

SCOPe Domain Sequences for d1w4qa_:

Sequence; same for both SEQRES and ATOM records:

>d1w4qa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1w4qa_:

• d1w4qa_ first appeared in SCOP 1.73, called d1w4qa1
  
• d1w4qa_ appears in SCOPe 2.07