Lineage for d1w4ob_ (1w4o B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928492Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2928523Domain d1w4ob_: 1w4o B: [120634]
    automated match to d1a2wa_
    complexed with ua3

Details for d1w4ob_

PDB Entry: 1w4o (more details), 1.6 Å

PDB Description: binding of nonnatural 3'-nucleotides to ribonuclease a
PDB Compounds: (B:) Pancreatic Ribonuclease A

SCOPe Domain Sequences for d1w4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ob_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1w4ob_:

Click to download the PDB-style file with coordinates for d1w4ob_.
(The format of our PDB-style files is described here.)

Timeline for d1w4ob_: