Lineage for d1w4nb3 (1w4n B:97-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935960Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2935961Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2935962Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2935963Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries)
    Uniprot P46881 9-628
  8. 2936043Domain d1w4nb3: 1w4n B:97-211 [120632]
    Other proteins in same PDB: d1w4na1, d1w4nb1
    automatically matched to d1av4_3
    complexed with cu, gol, na, so4

Details for d1w4nb3

PDB Entry: 1w4n (more details), 1.65 Å

PDB Description: agao covalent complex with tranylcypromine
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d1w4nb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4nb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d1w4nb3:

Click to download the PDB-style file with coordinates for d1w4nb3.
(The format of our PDB-style files is described here.)

Timeline for d1w4nb3: