Lineage for d1w4nb2 (1w4n B:9-96)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. Domain d1w4nb2: 1w4n B:9-96 [120631]
    Other proteins in same PDB: d1w4na1, d1w4nb1
    automatically matched to d1av4_2
    complexed with cu, gol, na, so4

Details for d1w4nb2

PDB Entry: 1w4n (more details), 1.6500000000000001 Å

PDB Description: agao covalent complex with tranylcypromine
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d1w4nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4nb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOPe Domain Coordinates for d1w4nb2 are not available.

Timeline for d1w4nb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w4nb1, d1w4nb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1w4na1, d1w4na2, d1w4na3