Lineage for d1w4nb1 (1w4n B:212-627)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044544Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2044545Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 protein domains)
  6. 2044546Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2044547Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
    Uniprot P46881 9-628
  8. 2044554Domain d1w4nb1: 1w4n B:212-627 [120630]
    Other proteins in same PDB: d1w4na2, d1w4na3, d1w4nb2, d1w4nb3
    automatically matched to d1av4_1
    complexed with cu, gol, na, so4

Details for d1w4nb1

PDB Entry: 1w4n (more details), 1.65 Å

PDB Description: agao covalent complex with tranylcypromine
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d1w4nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4nb1 b.30.2.1 (B:212-627) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignxdygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpa

SCOPe Domain Coordinates for d1w4nb1:

Click to download the PDB-style file with coordinates for d1w4nb1.
(The format of our PDB-style files is described here.)

Timeline for d1w4nb1: