SCOPe 2.08: Domain d1w4na1: 1w4n A:212-627

Lineage for d1w4na1 (1w4n A:212-627)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family)
   automatically mapped to Pfam PF01179

5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)

6. Protein Copper amine oxidase, domain 3 [50000] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [50003] (41 PDB entries)
   Uniprot P46881 9-628

8. Domain d1w4na1: 1w4n A:212-627 [120627]
   Other proteins in same PDB: d1w4na2, d1w4na3, d1w4nb2, d1w4nb3
   automatically matched to d1av4_1
   complexed with cu, gol, na, so4

Details for d1w4na1

PDB Entry: 1w4n, 1.65 Å

PDB Description: agao covalent complex with tranylcypromine

PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d1w4na1:

Sequence; same for both SEQRES and ATOM records:

>d1w4na1 b.30.2.1 (A:212-627) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignxdygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpa

Timeline for d1w4na1:

• d1w4na1 first appeared in SCOP 1.73
  
• d1w4na1 appears in SCOPe 2.07