| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.1: Reductases [52344] (5 proteins) |
| Protein automated matches [226995] (7 species) not a true protein |
| Species Anabaena pcc7119 [TaxId:1168] [254931] (1 PDB entry) |
| Domain d1w35a2: 1w35 A:142-303 [120623] Other proteins in same PDB: d1w35a1 automated match to d1ewya2 complexed with fad, so4; mutant |
PDB Entry: 1w35 (more details), 1.9 Å
SCOPe Domain Sequences for d1w35a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w35a2 c.25.1.1 (A:142-303) automated matches {Anabaena pcc7119 [TaxId: 1168]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetw
Timeline for d1w35a2: