Lineage for d1w35a1 (1w35 A:9-141)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544418Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1544455Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 1544560Protein automated matches [227029] (5 species)
    not a true protein
  7. Species Anabaena pcc7119 [TaxId:1168] [254930] (1 PDB entry)
  8. 1544562Domain d1w35a1: 1w35 A:9-141 [120622]
    Other proteins in same PDB: d1w35a2
    automated match to d1quea1
    complexed with fad, so4; mutant

Details for d1w35a1

PDB Entry: 1w35 (more details), 1.9 Å

PDB Description: ferredoxin-nadp+ reductase (mutation: y 303 w)
PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1w35a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w35a1 b.43.4.2 (A:9-141) automated matches {Anabaena pcc7119 [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOPe Domain Coordinates for d1w35a1:

Click to download the PDB-style file with coordinates for d1w35a1.
(The format of our PDB-style files is described here.)

Timeline for d1w35a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w35a2