SCOPe 2.08: Domain d1w35a1: 1w35 A:9-141

Lineage for d1w35a1 (1w35 A:9-141)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein automated matches [227029] (5 species)
   not a true protein

7. Species Anabaena pcc7119 [TaxId:1168] [254930] (1 PDB entry)

8. Domain d1w35a1: 1w35 A:9-141 [120622]
   Other proteins in same PDB: d1w35a2
   automated match to d1quea1
   complexed with fad, so4; mutant

Details for d1w35a1

PDB Entry: 1w35, 1.9 Å

PDB Description: ferredoxin-nadp+ reductase (mutation: y 303 w)

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1w35a1:

Sequence; same for both SEQRES and ATOM records:

>d1w35a1 b.43.4.2 (A:9-141) automated matches {Anabaena pcc7119 [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

Timeline for d1w35a1:

• d1w35a1 first appeared in SCOP 1.73
  
• d1w35a1 appears in SCOPe 2.07