Lineage for d1w34a2 (1w34 A:142-302)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827305Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 827306Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 827307Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 827318Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 827321Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (24 PDB entries)
  8. 827325Domain d1w34a2: 1w34 A:142-302 [120621]
    Other proteins in same PDB: d1w34a1
    automatically matched to d1e62a2
    complexed with fad, so4; mutant

Details for d1w34a2

PDB Entry: 1w34 (more details), 1.73 Å

PDB Description: ferredoxin-nadp reductase (mutation: y 303 s)
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOP Domain Sequences for d1w34a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w34a2 c.25.1.1 (A:142-302) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvet

SCOP Domain Coordinates for d1w34a2:

Click to download the PDB-style file with coordinates for d1w34a2.
(The format of our PDB-style files is described here.)

Timeline for d1w34a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w34a1