Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein automated matches [226995] (7 species) not a true protein |
Species Anabaena sp. [TaxId:1168] [254932] (3 PDB entries) |
Domain d1w34a2: 1w34 A:142-303 [120621] Other proteins in same PDB: d1w34a1 automated match to d1ewya2 complexed with fad, so4; mutant |
PDB Entry: 1w34 (more details), 1.73 Å
SCOPe Domain Sequences for d1w34a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w34a2 c.25.1.1 (A:142-303) automated matches {Anabaena sp. [TaxId: 1168]} lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvets
Timeline for d1w34a2: