Lineage for d1w31a1 (1w31 A:1-340)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 684374Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 684375Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 684376Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (12 PDB entries)
  8. 684381Domain d1w31a1: 1w31 A:1-340 [120619]
    automatically matched to d1h7ra_
    complexed with sho, zn

Details for d1w31a1

PDB Entry: 1w31 (more details), 1.9 Å

PDB Description: yeast 5-aminolaevulinic acid dehydratase 5-hydroxylaevulinic acid complex
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOP Domain Sequences for d1w31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w31a1 c.1.10.3 (A:1-340) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwlde

SCOP Domain Coordinates for d1w31a1:

Click to download the PDB-style file with coordinates for d1w31a1.
(The format of our PDB-style files is described here.)

Timeline for d1w31a1: