Lineage for d1w31a_ (1w31 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835458Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2835500Protein automated matches [190088] (4 species)
    not a true protein
  7. 2835501Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186810] (1 PDB entry)
  8. 2835502Domain d1w31a_: 1w31 A: [120619]
    automated match to d1h7ra_
    complexed with sho, zn

Details for d1w31a_

PDB Entry: 1w31 (more details), 1.9 Å

PDB Description: yeast 5-aminolaevulinic acid dehydratase 5-hydroxylaevulinic acid complex
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d1w31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w31a_ c.1.10.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwlde

SCOPe Domain Coordinates for d1w31a_:

Click to download the PDB-style file with coordinates for d1w31a_.
(The format of our PDB-style files is described here.)

Timeline for d1w31a_: