Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
Protein automated matches [190088] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186810] (1 PDB entry) |
Domain d1w31a_: 1w31 A: [120619] automated match to d1h7ra_ complexed with sho, zn |
PDB Entry: 1w31 (more details), 1.9 Å
SCOPe Domain Sequences for d1w31a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w31a_ c.1.10.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa ekgvvdlktiafeshqgflragarliitylapefldwlde
Timeline for d1w31a_: