![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (53 species) not a true protein |
![]() | Domain d1w2tf1: 1w2t F:295-432 [120617] Other proteins in same PDB: d1w2ta2, d1w2tb2, d1w2tc2, d1w2td2, d1w2te2, d1w2tf2 automated match to d1uypa1 complexed with cit, so4 |
PDB Entry: 1w2t (more details), 1.87 Å
SCOPe Domain Sequences for d1w2tf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2tf1 b.29.1.0 (F:295-432) automated matches {Thermotoga maritima [TaxId: 243274]} vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils vksnqvklevfeleniwl
Timeline for d1w2tf1: