Lineage for d1w2tf1 (1w2t F:295-432)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:243274] [254928] (1 PDB entry)
  8. 2781367Domain d1w2tf1: 1w2t F:295-432 [120617]
    Other proteins in same PDB: d1w2ta2, d1w2tb2, d1w2tc2, d1w2td2, d1w2te2, d1w2tf2
    automated match to d1uypa1
    complexed with cit, so4

Details for d1w2tf1

PDB Entry: 1w2t (more details), 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose
PDB Compounds: (F:) beta fructosidase

SCOPe Domain Sequences for d1w2tf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2tf1 b.29.1.0 (F:295-432) automated matches {Thermotoga maritima [TaxId: 243274]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl

SCOPe Domain Coordinates for d1w2tf1:

Click to download the PDB-style file with coordinates for d1w2tf1.
(The format of our PDB-style files is described here.)

Timeline for d1w2tf1: