SCOPe 2.03: Domain d1w2te2: 1w2t E:1-294

Lineage for d1w2te2 (1w2t E:1-294)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (2 proteins)
   Pfam PF00251; Glycosyl hydrolase family 32

6. Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101886] (2 PDB entries)

8. Domain d1w2te2: 1w2t E:1-294 [120616]
   Other proteins in same PDB: d1w2ta1, d1w2tb1, d1w2tc1, d1w2td1, d1w2te1, d1w2tf1
   automatically matched to d1uypa2
   complexed with cit, so4

Details for d1w2te2

PDB Entry: 1w2t, 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose

PDB Compounds: (E:) beta fructosidase

SCOPe Domain Sequences for d1w2te2:

Sequence; same for both SEQRES and ATOM records:

>d1w2te2 b.67.2.3 (E:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

Timeline for d1w2te2:

• d1w2te2 first appeared in SCOP 1.73
  
• d1w2te2 appears in SCOPe 2.02
  
• d1w2te2 appears in SCOPe 2.04
  
• d1w2te2 appears in the current release, SCOPe 2.08