Lineage for d1w2td2 (1w2t D:1-294)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416839Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2416849Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2416952Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (3 proteins)
    Pfam PF00251; Glycosyl hydrolase family 32
  6. Protein automated matches [254438] (1 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:243274] [254927] (1 PDB entry)
  8. 2416977Domain d1w2td2: 1w2t D:1-294 [120614]
    Other proteins in same PDB: d1w2ta1, d1w2tb1, d1w2tc1, d1w2td1, d1w2te1, d1w2tf1
    automated match to d1uypa2
    complexed with cit, so4

Details for d1w2td2

PDB Entry: 1w2t (more details), 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose
PDB Compounds: (D:) beta fructosidase

SCOPe Domain Sequences for d1w2td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2td2 b.67.2.3 (D:1-294) automated matches {Thermotoga maritima [TaxId: 243274]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

SCOPe Domain Coordinates for d1w2td2:

Click to download the PDB-style file with coordinates for d1w2td2.
(The format of our PDB-style files is described here.)

Timeline for d1w2td2: