SCOPe 2.04: Domain d1w2tc1: 1w2t C:295-432

Lineage for d1w2tc1 (1w2t C:295-432)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [254928] (1 PDB entry)

8. Domain d1w2tc1: 1w2t C:295-432 [120611]
   Other proteins in same PDB: d1w2ta2, d1w2tb2, d1w2tc2, d1w2td2, d1w2te2, d1w2tf2
   automated match to d1uypa1
   complexed with cit, so4

Details for d1w2tc1

PDB Entry: 1w2t, 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose

PDB Compounds: (C:) beta fructosidase

SCOPe Domain Sequences for d1w2tc1:

Sequence; same for both SEQRES and ATOM records:

>d1w2tc1 b.29.1.0 (C:295-432) automated matches {Thermotoga maritima [TaxId: 243274]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl

Timeline for d1w2tc1:

• d1w2tc1 first appeared in SCOP 1.73
  
• d1w2tc1 appears in SCOPe 2.03
  
• d1w2tc1 appears in SCOPe 2.05
  
• d1w2tc1 appears in the current release, SCOPe 2.08