Lineage for d1w2ta2 (1w2t A:1-294)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807084Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 807090Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 807150Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (2 proteins)
    Pfam PF00251; Glycosyl hydrolase family 32
  6. 807151Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species)
  7. 807152Species Thermotoga maritima [TaxId:2336] [101886] (2 PDB entries)
  8. 807159Domain d1w2ta2: 1w2t A:1-294 [120608]
    Other proteins in same PDB: d1w2ta1, d1w2tb1, d1w2tc1, d1w2td1, d1w2te1, d1w2tf1
    automatically matched to d1uypa2
    complexed with cit, gla, so4, suc; mutant

Details for d1w2ta2

PDB Entry: 1w2t (more details), 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose
PDB Compounds: (A:) beta fructosidase

SCOP Domain Sequences for d1w2ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2ta2 b.67.2.3 (A:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

SCOP Domain Coordinates for d1w2ta2:

Click to download the PDB-style file with coordinates for d1w2ta2.
(The format of our PDB-style files is described here.)

Timeline for d1w2ta2: