Lineage for d1w2ta1 (1w2t A:295-432)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664287Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins)
    Pfam PF08244
    flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand
  6. 664288Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species)
  7. 664289Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries)
  8. 664296Domain d1w2ta1: 1w2t A:295-432 [120607]
    Other proteins in same PDB: d1w2ta2, d1w2tb2, d1w2tc2, d1w2td2, d1w2te2, d1w2tf2
    automatically matched to d1uypa1
    complexed with cit, gla, so4, suc; mutant

Details for d1w2ta1

PDB Entry: 1w2t (more details), 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose
PDB Compounds: (A:) beta fructosidase

SCOP Domain Sequences for d1w2ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2ta1 b.29.1.19 (A:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl

SCOP Domain Coordinates for d1w2ta1:

Click to download the PDB-style file with coordinates for d1w2ta1.
(The format of our PDB-style files is described here.)

Timeline for d1w2ta1: