| Class b: All beta proteins [48724] (165 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
| Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins) Pfam PF08244 flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand |
| Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries) |
| Domain d1w2ta1: 1w2t A:295-432 [120607] Other proteins in same PDB: d1w2ta2, d1w2tb2, d1w2tc2, d1w2td2, d1w2te2, d1w2tf2 automatically matched to d1uypa1 complexed with cit, gla, so4, suc; mutant |
PDB Entry: 1w2t (more details), 1.87 Å
SCOP Domain Sequences for d1w2ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ta1 b.29.1.19 (A:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl
Timeline for d1w2ta1: