Lineage for d1w2sb2 (1w2s B:70-137)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963726Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1963727Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1963728Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1963924Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 1963925Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)
  8. 1963935Domain d1w2sb2: 1w2s B:70-137 [120606]
    Other proteins in same PDB: d1w2sa1
    automatically matched to d1ghqc2

Details for d1w2sb2

PDB Entry: 1w2s (more details)

PDB Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering
PDB Compounds: (B:) complement receptor type 2 precursor,

SCOPe Domain Sequences for d1w2sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2sb2 g.18.1.1 (B:70-137) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvsvfple

SCOPe Domain Coordinates for d1w2sb2:

Click to download the PDB-style file with coordinates for d1w2sb2.
(The format of our PDB-style files is described here.)

Timeline for d1w2sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w2sb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1w2sa1