Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement receptor 2, cr2 [64564] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries) |
Domain d1w2ra2: 1w2r A:70-137 [120603] automatically matched to d1ghqc2 |
PDB Entry: 1w2r (more details)
SCOPe Domain Sequences for d1w2ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ra2 g.18.1.1 (A:70-137) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt cvsvfple
Timeline for d1w2ra2: