| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
| Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) |
| Domain d1w2kt2: 1w2k T:109-209 [120589] Other proteins in same PDB: d1w2kh1, d1w2kl1, d1w2kl2, d1w2kl3 automatically matched to d1a21a2 complexed with 380, bgc, ca, cac, fuc |
PDB Entry: 1w2k (more details), 3 Å
SCOP Domain Sequences for d1w2kt2:
Sequence, based on SEQRES records: (download)
>d1w2kt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec
>d1w2kt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssgkktakt
ntneflidvdkgenycfsvqavipsrtvnrkstdspvec
Timeline for d1w2kt2:
View in 3DDomains from other chains: (mouse over for more information) d1w2kh1, d1w2kl1, d1w2kl2, d1w2kl3 |