| Class g: Small proteins [56992] (91 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
| Protein automated matches [226968] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries) |
| Domain d1w2kl1: 1w2k L:49-86 [120585] Other proteins in same PDB: d1w2kh_, d1w2kl2, d1w2kl3, d1w2kt1, d1w2kt2 automated match to d2a2ql1 complexed with 380, bgc, ca, cac, fuc |
PDB Entry: 1w2k (more details), 3 Å
SCOPe Domain Sequences for d1w2kl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2kl1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d1w2kl1: