Lineage for d1w2ha1 (1w2h A:1-208)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695371Protein Thymidylate kinase [52563] (4 species)
  7. 695409Species Mycobacterium tuberculosis [TaxId:1773] [69482] (11 PDB entries)
  8. 695421Domain d1w2ha1: 1w2h A:1-208 [120582]
    automatically matched to d1g3ua_
    complexed with act, atm

Details for d1w2ha1

PDB Entry: 1w2h (more details), 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with azidothymidine monophosphate (azt-mp) (2.0 a resolution)
PDB Compounds: (A:) thymidylate kinase tmk

SCOP Domain Sequences for d1w2ha1:

Sequence, based on SEQRES records: (download)

>d1w2ha1 c.37.1.1 (A:1-208) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

Sequence, based on observed residues (ATOM records): (download)

>d1w2ha1 c.37.1.1 (A:1-208) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagerdaelqqrtgavyaelaaqgwggrwlvvgadv
dpgrlaatla

SCOP Domain Coordinates for d1w2ha1:

Click to download the PDB-style file with coordinates for d1w2ha1.
(The format of our PDB-style files is described here.)

Timeline for d1w2ha1: