Lineage for d1w2ha_ (1w2h A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109738Protein automated matches [190087] (10 species)
    not a true protein
  7. 2109791Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)
  8. 2109796Domain d1w2ha_: 1w2h A: [120582]
    automated match to d1g3ua_
    complexed with act, atm

Details for d1w2ha_

PDB Entry: 1w2h (more details), 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with azidothymidine monophosphate (azt-mp) (2.0 a resolution)
PDB Compounds: (A:) thymidylate kinase tmk

SCOPe Domain Sequences for d1w2ha_:

Sequence, based on SEQRES records: (download)

>d1w2ha_ c.37.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatlap

Sequence, based on observed residues (ATOM records): (download)

>d1w2ha_ c.37.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagerdaelqqrtgavyaelaaqgwggrwlvvgadv
dpgrlaatlap

SCOPe Domain Coordinates for d1w2ha_:

Click to download the PDB-style file with coordinates for d1w2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1w2ha_: