Lineage for d1w2gb_ (1w2g B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866327Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)
  8. 2866337Domain d1w2gb_: 1w2g B: [120581]
    automated match to d1g3ua_
    complexed with act, thm

Details for d1w2gb_

PDB Entry: 1w2g (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with deoxythymidine (dt) (2.1 a resolution)
PDB Compounds: (B:) thymidylate kinase tmk

SCOPe Domain Sequences for d1w2gb_:

Sequence, based on SEQRES records: (download)

>d1w2gb_ c.37.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatlap

Sequence, based on observed residues (ATOM records): (download)

>d1w2gb_ c.37.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrardnyerdaelqqrtgavyaelaa
qgwggrwlvvgadvdpgrlaatlap

SCOPe Domain Coordinates for d1w2gb_:

Click to download the PDB-style file with coordinates for d1w2gb_.
(The format of our PDB-style files is described here.)

Timeline for d1w2gb_: