Lineage for d1w2ga1 (1w2g A:1-208)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829678Protein Thymidylate kinase [52563] (4 species)
  7. 829716Species Mycobacterium tuberculosis [TaxId:1773] [69482] (11 PDB entries)
  8. 829725Domain d1w2ga1: 1w2g A:1-208 [120580]
    automatically matched to d1g3ua_
    complexed with act, thm

Details for d1w2ga1

PDB Entry: 1w2g (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with deoxythymidine (dt) (2.1 a resolution)
PDB Compounds: (A:) thymidylate kinase tmk

SCOP Domain Sequences for d1w2ga1:

Sequence, based on SEQRES records: (download)

>d1w2ga1 c.37.1.1 (A:1-208) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

Sequence, based on observed residues (ATOM records): (download)

>d1w2ga1 c.37.1.1 (A:1-208) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagerrdnyerdaelqqrtgavyaelaaqgwggrwl
vvgadvdpgrlaatla

SCOP Domain Coordinates for d1w2ga1:

Click to download the PDB-style file with coordinates for d1w2ga1.
(The format of our PDB-style files is described here.)

Timeline for d1w2ga1: