![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.7: YfcE-like [111233] (5 proteins) |
![]() | Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160872] (5 PDB entries) |
![]() | Domain d1w24a_: 1w24 A: [120579] automated match to d1w24a1 |
PDB Entry: 1w24 (more details), 2.1 Å
SCOPe Domain Sequences for d1w24a_:
Sequence, based on SEQRES records: (download)
>d1w24a_ d.159.1.7 (A:) Vacuolar protein sorting 29, VPS29 {Human (Homo sapiens) [TaxId: 9606]} mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk kp
>d1w24a_ d.159.1.7 (A:) Vacuolar protein sorting 29, VPS29 {Human (Homo sapiens) [TaxId: 9606]} mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr gdfdenlnypeqkvvtvgqfkiglihghqvipdmaslallqrqfdvdilisghthkfeaf ehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieykkp
Timeline for d1w24a_: