Lineage for d1w1b21 (1w1b 2:24-258)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689577Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 689615Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (6 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 689627Protein Probable polysaccharide deacetylase PdaA [89560] (1 species)
  7. 689628Species Bacillus subtilis [TaxId:1423] [89561] (4 PDB entries)
  8. 689634Domain d1w1b21: 1w1b 2:24-258 [120578]
    automatically matched to d1ny1a_
    complexed with cd

Details for d1w1b21

PDB Entry: 1w1b (more details), 2.1 Å

PDB Description: structure of bacillus subtilis pdaa with cadmium, a family 4 carbohydrate esterase.
PDB Compounds: (2:) Probable polysaccharide deacetylase pdaA

SCOP Domain Sequences for d1w1b21:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1b21 c.6.2.3 (2:24-258) Probable polysaccharide deacetylase PdaA {Bacillus subtilis [TaxId: 1423]}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem

SCOP Domain Coordinates for d1w1b21:

Click to download the PDB-style file with coordinates for d1w1b21.
(The format of our PDB-style files is described here.)

Timeline for d1w1b21: