Lineage for d1w1a2_ (1w1a 2:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979433Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 979485Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (8 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 979546Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 979569Protein automated matches [190086] (3 species)
    not a true protein
  7. 979570Species Bacillus subtilis [TaxId:1423] [186808] (2 PDB entries)
  8. 979574Domain d1w1a2_: 1w1a 2: [120576]
    automated match to d1ny1a_
    complexed with cd, gol, ndg

Details for d1w1a2_

PDB Entry: 1w1a (more details), 2.25 Å

PDB Description: structure of bacillus subtilis pdaa in complex with nag, a family 4 carbohydrate esterase.
PDB Compounds: (2:) Probable polysaccharide deacetylase pdaA

SCOPe Domain Sequences for d1w1a2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1a2_ c.6.2.3 (2:) automated matches {Bacillus subtilis [TaxId: 1423]}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr

SCOPe Domain Coordinates for d1w1a2_:

Click to download the PDB-style file with coordinates for d1w1a2_.
(The format of our PDB-style files is described here.)

Timeline for d1w1a2_: