Lineage for d1w1a1_ (1w1a 1:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458768Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2458862Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2458934Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 2458955Protein automated matches [190086] (3 species)
    not a true protein
  7. 2458956Species Bacillus subtilis [TaxId:1423] [186808] (3 PDB entries)
  8. 2458961Domain d1w1a1_: 1w1a 1: [120575]
    automated match to d1ny1a_
    complexed with cd, gol, ndg

Details for d1w1a1_

PDB Entry: 1w1a (more details), 2.25 Å

PDB Description: structure of bacillus subtilis pdaa in complex with nag, a family 4 carbohydrate esterase.
PDB Compounds: (1:) Probable polysaccharide deacetylase pdaA

SCOPe Domain Sequences for d1w1a1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1a1_ c.6.2.3 (1:) automated matches {Bacillus subtilis [TaxId: 1423]}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr

SCOPe Domain Coordinates for d1w1a1_:

Click to download the PDB-style file with coordinates for d1w1a1_.
(The format of our PDB-style files is described here.)

Timeline for d1w1a1_: