Lineage for d1w17b1 (1w17 B:24-258)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155171Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1155243Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 1155304Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 1155315Protein Probable polysaccharide deacetylase PdaA [89560] (1 species)
  7. 1155316Species Bacillus subtilis [TaxId:1423] [89561] (2 PDB entries)
  8. 1155320Domain d1w17b1: 1w17 B:24-258 [120574]
    automatically matched to d1ny1a_

Details for d1w17b1

PDB Entry: 1w17 (more details), 1.9 Å

PDB Description: structure of bacillus subtilis pdaa, a family 4 carbohydrate esterase.
PDB Compounds: (B:) Probable polysaccharide deacetylase pdaA

SCOPe Domain Sequences for d1w17b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w17b1 c.6.2.3 (B:24-258) Probable polysaccharide deacetylase PdaA {Bacillus subtilis [TaxId: 1423]}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem

SCOPe Domain Coordinates for d1w17b1:

Click to download the PDB-style file with coordinates for d1w17b1.
(The format of our PDB-style files is described here.)

Timeline for d1w17b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w17a1