Lineage for d1w17a_ (1w17 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850644Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 2850665Protein automated matches [190086] (3 species)
    not a true protein
  7. 2850666Species Bacillus subtilis [TaxId:1423] [186808] (3 PDB entries)
  8. 2850667Domain d1w17a_: 1w17 A: [120573]
    automated match to d1w1b1_

Details for d1w17a_

PDB Entry: 1w17 (more details), 1.9 Å

PDB Description: structure of bacillus subtilis pdaa, a family 4 carbohydrate esterase.
PDB Compounds: (A:) Probable polysaccharide deacetylase pdaA

SCOPe Domain Sequences for d1w17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w17a_ c.6.2.3 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr

SCOPe Domain Coordinates for d1w17a_:

Click to download the PDB-style file with coordinates for d1w17a_.
(The format of our PDB-style files is described here.)

Timeline for d1w17a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w17b_