Lineage for d1w0yt2 (1w0y T:107-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371796Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2371797Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2371826Domain d1w0yt2: 1w0y T:107-210 [120572]
    Other proteins in same PDB: d1w0yh_, d1w0yl1, d1w0yl2, d1w0yl3
    automated match to d1j9ct2
    complexed with 771, bgc, ca, cac, fuc

Details for d1w0yt2

PDB Entry: 1w0y (more details), 2.5 Å

PDB Description: tf7a_3771 complex
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1w0yt2:

Sequence, based on SEQRES records: (download)

>d1w0yt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records): (download)

>d1w0yt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

SCOPe Domain Coordinates for d1w0yt2:

Click to download the PDB-style file with coordinates for d1w0yt2.
(The format of our PDB-style files is described here.)

Timeline for d1w0yt2: