![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) |
![]() | Domain d1w0yt1: 1w0y T:6-108 [120571] Other proteins in same PDB: d1w0yh1, d1w0yl1, d1w0yl2, d1w0yl3 automatically matched to d1a21a1 complexed with 771, bgc, ca, cac, fuc |
PDB Entry: 1w0y (more details), 2.5 Å
SCOP Domain Sequences for d1w0yt1:
Sequence, based on SEQRES records: (download)
>d1w0yt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagnvestgsageplyenspeftpyletnl
>d1w0yt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tvaaynltwkstnfktilewepkvytvqistksgdwkskcfyttdtecdltdeivkdvkq tylarvfsypeplyenspeftpyletnl
Timeline for d1w0yt1:
![]() Domains from other chains: (mouse over for more information) d1w0yh1, d1w0yl1, d1w0yl2, d1w0yl3 |