![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein automated matches [190092] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries) |
![]() | Domain d1w0yl2: 1w0y L:87-142 [120569] Other proteins in same PDB: d1w0yh_, d1w0yl1, d1w0yl3, d1w0yt1, d1w0yt2 automated match to d2a2ql2 complexed with 771, bgc, ca, cac, fuc |
PDB Entry: 1w0y (more details), 2.5 Å
SCOPe Domain Sequences for d1w0yl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0yl2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d1w0yl2: