Lineage for d1w0yl2 (1w0y L:87-142)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2583120Protein automated matches [190092] (2 species)
    not a true protein
  7. 2583121Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries)
  8. 2583173Domain d1w0yl2: 1w0y L:87-142 [120569]
    Other proteins in same PDB: d1w0yh_, d1w0yl1, d1w0yl3, d1w0yt1, d1w0yt2
    automated match to d2a2ql2
    complexed with 771, bgc, ca, cac, fuc

Details for d1w0yl2

PDB Entry: 1w0y (more details), 2.5 Å

PDB Description: tf7a_3771 complex
PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w0yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0yl2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d1w0yl2:

Click to download the PDB-style file with coordinates for d1w0yl2.
(The format of our PDB-style files is described here.)

Timeline for d1w0yl2: