| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
| Protein automated matches [226968] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries) |
| Domain d1w0yl1: 1w0y L:49-86 [120568] Other proteins in same PDB: d1w0yh_, d1w0yl2, d1w0yl3, d1w0yt1, d1w0yt2 automated match to d2a2ql1 complexed with 771, bgc, ca, cac, fuc |
PDB Entry: 1w0y (more details), 2.5 Å
SCOPe Domain Sequences for d1w0yl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0yl1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d1w0yl1: