Lineage for d1w0yl1 (1w0y L:49-86)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961820Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1961821Protein automated matches [226968] (3 species)
    not a true protein
  7. 1961822Species Human (Homo sapiens) [TaxId:9606] [225423] (24 PDB entries)
  8. 1961836Domain d1w0yl1: 1w0y L:49-86 [120568]
    Other proteins in same PDB: d1w0yh_, d1w0yl2, d1w0yl3, d1w0yt1, d1w0yt2
    automated match to d2a2ql1
    complexed with 771, bgc, ca, cac, fuc

Details for d1w0yl1

PDB Entry: 1w0y (more details), 2.5 Å

PDB Description: tf7a_3771 complex
PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w0yl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0yl1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d1w0yl1:

Click to download the PDB-style file with coordinates for d1w0yl1.
(The format of our PDB-style files is described here.)

Timeline for d1w0yl1: