| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Factor IX (IXa) [57198] (2 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
| Domain d1w0yl1: 1w0y L:46-82 [120568] Other proteins in same PDB: d1w0yh1, d1w0yl3, d1w0yt1, d1w0yt2 automatically matched to d1pfxl1 complexed with 771, bgc, ca, cac, fuc |
PDB Entry: 1w0y (more details), 2.5 Å
SCOP Domain Sequences for d1w0yl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0yl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce
Timeline for d1w0yl1: