SCOP 1.75: Domain d1w0yl1: 1w0y L:46-82

Lineage for d1w0yl1 (1w0y L:46-82)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d1w0yl1: 1w0y L:46-82 [120568]
   Other proteins in same PDB: d1w0yh1, d1w0yl3, d1w0yt1, d1w0yt2
   automatically matched to d1pfxl1
   complexed with 771, bgc, ca, cac, fuc

Details for d1w0yl1

PDB Entry: 1w0y, 2.5 Å

PDB Description: tf7a_3771 complex

PDB Compounds: (L:) blood coagulation factor viia

SCOP Domain Sequences for d1w0yl1:

Sequence; same for both SEQRES and ATOM records:

>d1w0yl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

Timeline for d1w0yl1:

• d1w0yl1 first appeared in SCOP 1.73
  
• d1w0yl1 appears in SCOPe 2.01
  
• d1w0yl1 appears in the current release, SCOPe 2.08