SCOPe 2.08: Domain d1w0yl1: 1w0y L:49-86

Lineage for d1w0yl1 (1w0y L:49-86)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)

8. Domain d1w0yl1: 1w0y L:49-86 [120568]
   Other proteins in same PDB: d1w0yh_, d1w0yl2, d1w0yl3, d1w0yt1, d1w0yt2
   automated match to d2a2ql1
   complexed with 771, bgc, ca, cac, fuc

Details for d1w0yl1

PDB Entry: 1w0y, 2.5 Å

PDB Description: tf7a_3771 complex

PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w0yl1:

Sequence; same for both SEQRES and ATOM records:

>d1w0yl1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d1w0yl1:

• d1w0yl1 first appeared in SCOP 1.73
  
• d1w0yl1 appears in SCOPe 2.07