Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Coagulation factor VIIa [50550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50551] (33 PDB entries) |
Domain d1w0yh1: 1w0y H:16-257 [120567] Other proteins in same PDB: d1w0yl1, d1w0yl2, d1w0yl3, d1w0yt1, d1w0yt2 automatically matched to d1cvwh_ complexed with 771, bgc, ca, cac, fuc |
PDB Entry: 1w0y (more details), 2.5 Å
SCOP Domain Sequences for d1w0yh1:
Sequence, based on SEQRES records: (download)
>d1w0yh1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
>d1w0yh1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkspniteymfcagysdg skdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrsep rpgvllrapfp
Timeline for d1w0yh1: