Lineage for d1w0wa1 (1w0w A:182-276)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514415Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1514416Species Human (Homo sapiens) [TaxId:9606] [88605] (187 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1514508Domain d1w0wa1: 1w0w A:182-276 [120563]
    Other proteins in same PDB: d1w0wa2, d1w0wb_
    automatically matched to d1m6oa1
    complexed with gol

Details for d1w0wa1

PDB Entry: 1w0w (more details), 2.1 Å

PDB Description: crystal structure of hla-b*2709 complexed with the self-peptide tis from egf-response factor 1
PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1w0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0wa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d1w0wa1:

Click to download the PDB-style file with coordinates for d1w0wa1.
(The format of our PDB-style files is described here.)

Timeline for d1w0wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w0wa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1w0wb_