Lineage for d1w05a_ (1w05 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815434Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 2815464Protein Isopenicillin N synthase [51199] (3 species)
  7. 2815468Species Emericella nidulans [TaxId:162425] [51200] (27 PDB entries)
    Uniprot P05326
  8. 2815492Domain d1w05a_: 1w05 A: [120558]
    automated match to d1bk0__
    complexed with fe2, so4, w05

Details for d1w05a_

PDB Entry: 1w05 (more details), 2.46 Å

PDB Description: isopenicillin n synthase aminoadipoyl-cysteinyl-alanine-fe complex
PDB Compounds: (A:) isopenicillin n synthetase

SCOPe Domain Sequences for d1w05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w05a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOPe Domain Coordinates for d1w05a_:

Click to download the PDB-style file with coordinates for d1w05a_.
(The format of our PDB-style files is described here.)

Timeline for d1w05a_: