SCOP 1.75: Domain d1w03a1: 1w03 A:3-331

Lineage for d1w03a1 (1w03 A:3-331)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (4 proteins)
   common fold is rather distorted

6. Protein Isopenicillin N synthase [51199] (1 species)

7. Species Emericella nidulans [TaxId:162425] [51200] (29 PDB entries)
   Uniprot P05326

8. Domain d1w03a1: 1w03 A:3-331 [120556]
   automatically matched to d1bk0__
   complexed with fe2, hcg, so4

Details for d1w03a1

PDB Entry: 1w03, 2.1 Å

PDB Description: isopenicillin n synthase aminoadipoyl-cysteinyl-glycine-fe complex

PDB Compounds: (A:) isopenicillin n synthetase

SCOP Domain Sequences for d1w03a1:

Sequence; same for both SEQRES and ATOM records:

>d1w03a1 b.82.2.1 (A:3-331) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

Timeline for d1w03a1:

• d1w03a1 first appeared in SCOP 1.73
  
• d1w03a1 is called d1w03a_ in SCOPe 2.01
  
• d1w03a1 appears in the current release, SCOPe 2.08, called d1w03a_